PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G406600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 696aa    MW: 77167.6 Da    PI: 6.3906
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G406600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74e-183788656
                       S--HHHHHHHHHHHHH.SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  6 tftkeqleeLeelFek.nrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       ++tkeq+++Lee++++ ++yp+++e  +LA+k+gL  rqV +WFqNrR  ek
  Aqcoe3G406600.1.p 37 RHTKEQIKQLEEFYQEeSPYPDKKETDDLATKTGLHPRQVGYWFQNRRSIEK 88
                       589************99*******************************8776 PP

2START109.36.2e-352174335205
                        HHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
              START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                          + e++k+a+ +ep+W++s       ++  +++  f++++      ++ea++ +++   + +   +++     +W + ++    +ae++ v
  Aqcoe3G406600.1.p 217 NSMSEFLKLAQINEPLWKSSTdairNDLDIVTYINMFKKDNYlkanARIEASKKIVIHLKTIE--CQIYTCAQNKWMQCFPtivpEAEVIRV 306
                        6799*****************998888888888999988777888889999998888777777..44444444468888888888******* PP

                        ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
              START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                          +g      g+lqlm++   +lspl++ R+ +f+Ry+ q ++g w++vd S ++++++    ++vR  +lpSg+li+ + ng ++vtwveh
  Aqcoe3G406600.1.p 307 EATGiegnpcGTLQLMSQVIHFLSPLAChRELYFLRYCLQIEQGLWAVVDFSWNPPKERKIVYPIVR--KLPSGCLIQGMRNGCTRVTWVEH 396
                        ***********************************************************99888888..*********************** PP

                        EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
              START 170 vdlkgrlp.hwllrslvksglaegaktwvatlqrqce 205
                        v++++r+  h l+r  + +g+a+ga +w +tlqr  e
  Aqcoe3G406600.1.p 397 VEVEDRSLiHPLVRDHIFNGVAFGAGRWISTLQRISE 433
                        ****99877************************9776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003893.1E-113194IPR001356Homeobox domain
SuperFamilySSF466892.99E-143590IPR009057Homeodomain-like
CDDcd000863.08E-133588No hitNo description
Gene3DG3DSA:1.10.10.602.4E-153690IPR009057Homeodomain-like
PfamPF000461.5E-153788IPR001356Homeobox domain
PROSITE profilePS5007114.5283990IPR001356Homeobox domain
PROSITE profilePS5084827.862204437IPR002913START domain
SuperFamilySSF559619.78E-19211434No hitNo description
CDDcd088753.35E-66211433No hitNo description
SMARTSM002343.5E-16213434IPR002913START domain
PfamPF018522.9E-28217433IPR002913START domain
SuperFamilySSF559612.09E-8458632No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MLNAPAAGGL GGGLGGDDDD GINPNVEGIP PWPCQYRHTK EQIKQLEEFY QEESPYPDKK  60
ETDDLATKTG LHPRQVGYWF QNRRSIEKSN GHPASGPDGR TKRSSAYRDS KEASSLNISE  120
GDSNVQATSS NLDSYADNQG ISTLPMQTTE IPVAQEVPLV DVATTSTNQL STQGVATPVL  180
NQAPYQTRPA DIPTLPEPII ELLESELSPF MIDVAYNSMS EFLKLAQINE PLWKSSTDAI  240
RNDLDIVTYI NMFKKDNYLK ANARIEASKK IVIHLKTIEC QIYTCAQNKW MQCFPTIVPE  300
AEVIRVEATG IEGNPCGTLQ LMSQVIHFLS PLACHRELYF LRYCLQIEQG LWAVVDFSWN  360
PPKERKIVYP IVRKLPSGCL IQGMRNGCTR VTWVEHVEVE DRSLIHPLVR DHIFNGVAFG  420
AGRWISTLQR ISERLEFSPA TGATNPDNQL AGGIISSDTG RKNLMKLSQM MINNFFASIN  480
TSHRQKWSTL SRANDIQVRM SYRDETQPVK ADGLIIGAAT STWLPLPPKE VFDFLRKETA  540
RPKWDIHSFG YALNEIAYIV NGSEPGNRIS VLEAVDQRKG IKMLILQESS TDLSGSLVVH  600
SPISMDVLSS LTTEQDLSQI ELLPSGMAIF PAGRLTNRRD GASSSSSRSS AGSLLTLGFQ  660
TTLSDLLCEK LDLEAINKAR NTLKRNVIRL KSALK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.11e-113homeodomain GLABROUS 12